PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc02875.1.g00010.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family M-type_MADS
Protein Properties Length: 350aa    MW: 38636.5 Da    PI: 11.7614
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc02875.1.g00010.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF81.84.6e-26959151
                                  S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
                        SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                                  krien+ nrqvtf+kRr+g++KKA+ELS+LCda + vi+f +tg+ly++ss
  Zpz_sc02875.1.g00010.1.am.mk  9 KRIENEANRQVTFTKRRAGMFKKAKELSILCDALIGVIVFTNTGQLYDFSS 59
                                  79***********************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004323.4E-33160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006628.413161IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.7E-27378IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
CDDcd002653.15E-38377No hitNo description
PRINTSPR004044.1E-24323IPR002100Transcription factor, MADS-box
PfamPF003194.5E-231057IPR002100Transcription factor, MADS-box
PRINTSPR004044.1E-242338IPR002100Transcription factor, MADS-box
PRINTSPR004044.1E-243859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 350 aa     Download sequence    Send to blast
MVRGKTILKR IENEANRQVT FTKRRAGMFK KAKELSILCD ALIGVIVFTN TGQLYDFSSS  60
SMRSIIERYR HVKEGQQYVA ASTEAKPSHM EAVGVAPQLG WGRRRDRGGA KGGLKVVDHD  120
WPWRLPSSMP SVRWTRMAPS RSPYLCTRCV LDADELPGTV LHLCVLAARC RASGRRPSSS  180
QKWRDRTQPQ CSASPPIPNV AHSIPTSFSP PFQFPPLSLS LLTQECASTE PRTTPMLLPC  240
PPRHQPSRLR SPTRRPPHSP LRATTSSIAS AQHRLSCAPD PDARLAGPSS LPSTMAGLPR  300
RLSIPMHHSP GTGVSHRRPR SRASVFLVPP SNHDVPVPSQ AITAIHLPRR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1egw_D1e-15377276MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C1e-15377276MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B1e-15377276MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_A1e-15377276MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
3p57_J1e-15377276Myocyte-specific enhancer factor 2A
3p57_I1e-15377276Myocyte-specific enhancer factor 2A
3p57_D1e-15377276Myocyte-specific enhancer factor 2A
3p57_C1e-15377276Myocyte-specific enhancer factor 2A
3p57_B1e-15377276Myocyte-specific enhancer factor 2A
3p57_A1e-15377276Myocyte-specific enhancer factor 2A
3kov_J1e-15377276Myocyte-specific enhancer factor 2A
3kov_I1e-15377276Myocyte-specific enhancer factor 2A
3kov_B1e-15377276Myocyte-specific enhancer factor 2A
3kov_A1e-15377276Myocyte-specific enhancer factor 2A
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP7232422
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G14210.12e-30AGAMOUS-like 44